ConSurf Logo The ConSurf Server
Server for the Identification of Functional Regions in Proteins
  HOME   GALLERY   OVERVIEW   QUICK HELP   FAQ   CITING & CREDITS   OLD VERSION   CONSURF-DB   TERMS OF USE

ConSurf Job Status Page - FINISHED

Go to the results


If you wish to view these results at a later time without recalculating them, please bookmark this page. The results will be kept on the server for three months.

Job number and title:

Job number 1262549167, titled:

Running Parameters:

Structure
   Not Given. Running in 'ConSeq' mode
Alignment
   Multiple Sequence Alignment was built using MAFFT
   The Homologues were collected from SWISS-PROT
   PSI-BLAST E-value: 0.001
   No. of PSI-BLAST Iterations: 1
   Maximal %ID Between Sequences : 95
   Minimal %ID For Homologs : 35
   Max. Number of Homologues:50

Phylogenetic Tree
   Neighbor Joining with ML distance
Conservation Scores
   Method of Calculation: Bayesian
   Model of substitution for proteins: JTT

Running Messages:

ConSurf calculation is finished:

Final Results

Sequences Data

Alignment

      Alignment details
      The average number of replacements between any two sequences in the alignment;
      A distance of 0.01 means that on average, the expected replacement for every 100 positions is 1.
      Average pairwise distance : 0.712324
      Lower bound : 0.0202627
      Upper bound : 1.72475

Phylogenetic Tree

When looking for known structures that share high similarity with your sequence, we have found 3 relevant structures. See list bellow.
+ PDB:1EFE CHAIN: A | Show Alignment | Show PDB Details

>1EFEA 60 NMR NA NA NA no MINI-PROINSULIN  [HOMO
          Length = 60

 Score =  106 bits (264), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 56/86 (65%), Positives = 57/86 (66%), Gaps = 26/86 (30%)

Query: 25  FVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGGGPGAGSLQPLALEG 84
           FVNQHLCGSHLVEALYLVCGERGFFYTPKTRR   D+                       
1EFEA: 1   FVNQHLCGSHLVEALYLVCGERGFFYTPKTRRYPGDV----------------------- 37

Query: 85  SLQKRGIVEQCCTSICSLYQLENYCN 110
              KRGIVEQCCTSICSLYQLENYCN
1EFEA: 38  ---KRGIVEQCCTSICSLYQLENYCN 60


   PDB ID: 1EFE Chain: A
   %Identity between query and PDB: 65.1162790697674
   %Similarity between query and PDB: 66.2790697674419
   PSI-blast E-Value: 4e-24
   Length of alignment overlap with query: 86
   Length of alignment overlap with PDB: 60
   Descriptions: 60 NMR NA NA NA no MINI-PROINSULIN [HOMO SAPIENS]
   Learn more about the protein on Proteopedia | PDB
+ PDB:2JZQ CHAIN: A | Show Alignment | Show PDB Details

>2JZQA 57 NMR NA NA NA no Insulin  [SYNTHETIC
          Length = 57

 Score = 90.9 bits (224), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 52/86 (60%), Positives = 53/86 (61%), Gaps = 29/86 (33%)

Query: 25  FVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGGGPGAGSLQPLALEG 84
           FVNQHLCGS LVEALYLVCGERGFFYT  T              GGGP            
2JZQA: 1   FVNQHLCGSDLVEALYLVCGERGFFYTDPT--------------GGGP------------ 34

Query: 85  SLQKRGIVEQCCTSICSLYQLENYCN 110
              +RGIVEQCC SICSLYQLENYCN
2JZQA: 35  ---RRGIVEQCCHSICSLYQLENYCN 57


   PDB ID: 2JZQ Chain: A
   %Identity between query and PDB: 60.4651162790698
   %Similarity between query and PDB: 61.6279069767442
   PSI-blast E-Value: 2e-19
   Length of alignment overlap with query: 86
   Length of alignment overlap with PDB: 57
   Descriptions: 57 NMR NA NA NA no Insulin [SYNTHETIC CONSTRUCT]
   Learn more about the protein on Proteopedia | PDB
+ PDB:6INS CHAIN: E | Show Alignment | Show PDB Details

>6INSE 50 XRAY 2.00 0.179 NA no INSULIN  [SUS SCROFA]
          Length = 50

 Score = 89.0 bits (219), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 50/86 (58%), Positives = 50/86 (58%), Gaps = 36/86 (41%)

Query: 25  FVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGGGPGAGSLQPLALEG 84
           FVNQHLCGSHLVEALYLVCGERGFFYTPK                               
6INSE: 1   FVNQHLCGSHLVEALYLVCGERGFFYTPK------------------------------- 29

Query: 85  SLQKRGIVEQCCTSICSLYQLENYCN 110
                GIVEQCCTSICSLYQLENYCN
6INSE: 30  -----GIVEQCCTSICSLYQLENYCN 50


   PDB ID: 6INS Chain: E
   %Identity between query and PDB: 58.1395348837209
   %Similarity between query and PDB: 58.1395348837209
   PSI-blast E-Value: 8e-19
   Length of alignment overlap with query: 86
   Length of alignment overlap with PDB: 50
   Descriptions: 50 XRAY 2.00 0.179 NA no INSULIN [SUS SCROFA] || 6INSF
   Learn more about the protein on Proteopedia | PDB