Running Messages:

ConSurf calculation is finished:

Final Results

Sequence Data

Alignment

      Alignment details
      The average number of replacements between any two sequences in the alignment;
      A distance of 0.01 means that on average, the expected replacement for every 100 positions is 1.
      Average pairwise distance : 0.802216
      Lower bound : 1.01758e-07
      Upper bound : 1.95116

Phylogenetic Tree




Project ConSurf results on known structures similar to your sequence
When looking for known structures that share high similarity with your sequence, we have found 4 relevant structures.
Press here to show the list.
Press on the plus sign ('+') near each structure id to show the relevant links for that structure.
+ PDB:2KQP CHAIN: A | Show Alignment | Show PDB Details

   PDB ID: 2KQP Chain: A
   %Identity between query and PDB: 96.5116279069768
   %Similarity between query and PDB: 96.5116279069768
   PSI-blast E-Value: 2e-42
   Length of alignment overlap with query: 86
   Length of alignment overlap with PDB: 86
   Descriptions: EA14090CFFEA77F0 86 NMR NA NA NA no Insulin [Homo sapiens]
   Learn more about the protein on Proteopedia | PDB
+ PDB:1EFE CHAIN: A | Show Alignment | Show PDB Details

>1EFEA FF6402C114868997 60 NMR NA NA NA no Insulin 
          Length = 60

 Score =  105 bits (263), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 57/86 (66%), Gaps = 26/86 (30%)

Query: 25  FVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGGGPGAGSLQPLALEG 84
           FVNQHLCGSHLVEALYLVCGERGFFYTPKTRR   D+                       
1EFEA: 1   FVNQHLCGSHLVEALYLVCGERGFFYTPKTRRYPGDV----------------------- 37

Query: 85  SLQKRGIVEQCCTSICSLYQLENYCN 110
              KRGIVEQCCTSICSLYQLENYCN
1EFEA: 38  ---KRGIVEQCCTSICSLYQLENYCN 60


   PDB ID: 1EFE Chain: A
   %Identity between query and PDB: 65.1162790697674
   %Similarity between query and PDB: 66.2790697674419
   PSI-blast E-Value: 1e-23
   Length of alignment overlap with query: 86
   Length of alignment overlap with PDB: 60
   Descriptions: FF6402C114868997 60 NMR NA NA NA no Insulin [Homo sapiens]
   Learn more about the protein on Proteopedia | PDB
+ PDB:2LWZ CHAIN: A | Show Alignment | Show PDB Details

>2LWZA 02DC70B294CD6F38 57 NMR NA NA NA no Insulin 
          Length = 57

 Score = 90.9 bits (224), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 53/86 (61%), Gaps = 29/86 (33%)

Query: 25  FVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGGGPGAGSLQPLALEG 84
           FVNQHLCGS LVEALYLVCGERGFFYT  T              GGGP            
2LWZA: 1   FVNQHLCGSDLVEALYLVCGERGFFYTDPT--------------GGGP------------ 34

Query: 85  SLQKRGIVEQCCTSICSLYQLENYCN 110
              +RGIVEQCC SICSLYQLENYCN
2LWZA: 35  ---RRGIVEQCCHSICSLYQLENYCN 57


   PDB ID: 2LWZ Chain: A
   %Identity between query and PDB: 60.4651162790698
   %Similarity between query and PDB: 61.6279069767442
   PSI-blast E-Value: 5e-19
   Length of alignment overlap with query: 86
   Length of alignment overlap with PDB: 57
   Descriptions: 02DC70B294CD6F38 57 NMR NA NA NA no Insulin [Homo sapiens]
   Learn more about the protein on Proteopedia | PDB
+ PDB:2JZQ CHAIN: A | Show Alignment | Show PDB Details

>2JZQA 02DC70B294CD6F38 57 NMR NA NA NA no Insulin 
          Length = 57

 Score = 90.9 bits (224), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 53/86 (61%), Gaps = 29/86 (33%)

Query: 25  FVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGGGPGAGSLQPLALEG 84
           FVNQHLCGS LVEALYLVCGERGFFYT  T              GGGP            
2JZQA: 1   FVNQHLCGSDLVEALYLVCGERGFFYTDPT--------------GGGP------------ 34

Query: 85  SLQKRGIVEQCCTSICSLYQLENYCN 110
              +RGIVEQCC SICSLYQLENYCN
2JZQA: 35  ---RRGIVEQCCHSICSLYQLENYCN 57


   PDB ID: 2JZQ Chain: A
   %Identity between query and PDB: 60.4651162790698
   %Similarity between query and PDB: 61.6279069767442
   PSI-blast E-Value: 5e-19
   Length of alignment overlap with query: 86
   Length of alignment overlap with PDB: 57
   Descriptions: 02DC70B294CD6F38 57 NMR NA NA NA no Insulin [Homo sapiens]
   Learn more about the protein on Proteopedia | PDB